Diamond Floral Drop Earring for Cartilage Piercing

Regular price $1,148.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Here is our Diamond Flower Drop Earring, which you can preserve forever! Showcasing Round Diamond on the top while dainty round diamonds embellished on the floral motif, crafted with Solid Metal.

  • Wear it solo or stack this Diamond Floral Earring with simple hoops or stud earrings, and you will surely steal the spotlight.
  • You can wear this Diamond Earring on your multiple piercings like Helix, Cartilage, or Upper Lobe Piercing. Its playful, chic, and dances with your every move.
  • What are you still waiting for? Grab this Diamond Piercing Earring to amp up your boring ear-piercing stack look.
Product Information
SKU SHP-BODYJ052310052
Metal Weight 1.00 gm (Approximate)
Total Stone Weight 0.24 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-5 Pcs
Round-1.80X1.80 mm-1 Pcs
Round-2.50X2.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More