Genuine Diamond Butterfly Earring for Cartilage Piercing

Regular price $1,377.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Delicate Accent for Cartilage Piercings

The Genuine Diamond Butterfly Earring for Cartilage Piercing is designed for those who prefer subtle symbolism with refined detailing. The butterfly motif brings softness and lightness to curated ear styling, making it suitable for cartilage placements where scale and proportion matter.

Its compact form allows it to complement other studs and hoops without overwhelming the ear, making it a considered choice for everyday wear.

Butterfly Design with Secure Construction

The butterfly silhouette is shaped to maintain visual clarity while keeping the structure balanced. Each diamond is set to enhance the outline of the motif, creating controlled brilliance without excessive projection.

Specific information regarding backing type, post thickness, dimensions, metal options, and diamond details is provided in the product tables above and should be reviewed to ensure suitability for your piercing.

Diamond Durability and Everyday Wear

Diamonds are known for their hardness, making them appropriate for fine jewelry intended for frequent use. When properly secured and periodically inspected, they maintain their brilliance over time.

As with all cartilage jewelry, careful handling during insertion and removal helps preserve both the setting and overall finish.

High-Level Features

  • Butterfly motif accented with genuine diamonds.
  • Designed specifically for cartilage placement.
  • Balanced profile suited for curated ear styling.
  • Complete technical specifications available in the tables above.
Product Information
SKU SHP-BODYJ082410081
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.20 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Pear-2.00X3.50 mm-1 Pcs
Pear-2X3 mm-1 Pcs
Round-1.70X1.70 mm-1 Pcs
Color HI
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs about: Genuine Diamond Butterfly Earring for Cartilage Piercing

Is this butterfly earring sold as a single piece or a pair?
Cartilage earrings are commonly offered as single pieces. Please check the product selection and specification tables above to confirm what is included with this item.
Is this suitable for a healed cartilage piercing?
This earring is intended for use in fully healed cartilage piercings. Always consult your piercer if you are unsure about compatibility with your specific placement.
Will the butterfly design sit flat against the ear?
The design is crafted to maintain a balanced profile for cartilage styling. For exact depth and projection, please review the measurements listed in the product detail tables.
What metal options are available?
Available metal types and finishes are listed on the product page and detailed in the specification tables above.
How should I care for a diamond cartilage earring?
Clean gently with mild soap and water, and periodically inspect the setting to ensure security. Avoid exposure to harsh chemicals that may affect the metal finish.