Diamond Bar Earring for Tragus Piercing

Sale price $845.00 Regular price $971.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The Diamond Bar Earring is perfect to complete your outfit and complement your personality. Crafted in hallmarked metal, featuring petite round diamonds secured by pave setting on a bar motif.

  • You can simple slide this gold bar earring in your Cartilage, Tragus, Helix, or Upper Lobe, choice is yours. And guess what? This earring comes with a Flat Back Closure, that will keep it secured in place.
  • Whether you are brunching with friends or going on a date night, our bar stud earring is your ride-or-die accessory.
  • Make your special ones day a bit extra special, with this diamond piercing earring. Perfect for gifting on birthdays, anniversaries, or graduations.
Product Information
SKU SHP-BODYJ082410094
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.07 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More