Freshwater Pearl and Blue Sapphire Teardrop Earrings with Moissanite

Regular price $2,002.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These breathtaking Freshwater Pearl Drop Earrings are an exquisite celebration of elegance and symbolism, thoughtfully designed for brides seeking a timeless yet meaningful adornment on their special day. Crafted with careful attention to detail, each earring showcases a graceful union of classic beauty and refined artistry. At the top of these Pearl Teardrop Earrings is a captivating 3X5 MM pear shaped blue sapphire flanked by an intricate leaf-like design that is encrusted with sparkling round lab grown diamonds. Suspended from this shimmering upper motif is a luminous 6X9 MM Freshwater Pearl in an elegant teardrop shape. A bead setting secures the pearl in place, seamlessly connecting it to the rest of the earring while adding a contemporary edge to the classic form. These Bridal Pearl Earrings encapsulate the perfect blend of modern refinement and symbolic richness. Ideal for brides, they are more than just accessories - they are heirloom-worthy pieces that capture the essence of love, beauty, and transformation on one of life’s most cherished days.

Product Information
SKU SHP-EARRINGS062210038
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 6.27 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 5.48 Carat (Approximate)
Dimension(approx) Drops-6X9 mm-2 Pcs
Color White
Cut Brilliant
Shape Drops
Setting Type Bead-Set
Quality Grade AAA
BLUE SAPPHIRE INFORMATION
No.of Stones 34 Pieces
Total Weight 0.79 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-4 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-4 Pcs
Color Blue
Cut Brilliant
Shape Pear, Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
blue-sapphire-earrings