Natural Aquamarine Flower Inspired Engagement Ring With Diamond

Sale price $2,707.00 Regular price $3,042.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Flower Inspired Aquamarine and Diamond Engagement Ring

This engagement ring features an aquamarine center stone complemented by diamond accents arranged in a flower inspired design. The soft blue hue of aquamarine is highlighted by the surrounding stones, creating a balanced composition that reflects both gemstone color and intricate detailing.

The floral inspiration introduces a decorative element while maintaining the refined structure expected in classic engagement ring styles.

Floral Inspired Ring Design

Flower inspired engagement rings draw from natural forms, using petal-like arrangements and organic patterns to create a distinctive visual structure. This approach introduces softness and movement into the ring design while maintaining symmetry around the center gemstone.

The floral motif helps frame the aquamarine, giving the ring a decorative yet elegant character.

Aquamarine Center Stone

Aquamarine is valued for its light blue color and transparent clarity, making it a popular gemstone choice in engagement jewelry. Its calm hue offers a distinctive alternative to traditional center stones while maintaining a refined and classic aesthetic.

The gemstone’s clarity allows light to pass through the stone, contributing to its subtle brilliance and soft visual appeal.

Diamond Accent Details

Diamond accents are often used in engagement ring designs to enhance brightness and highlight the center gemstone. Their reflective properties introduce additional sparkle that complements the color of aquamarine.

Together, the aquamarine center stone and diamond accents create a balanced design that blends color, brilliance, and intricate craftsmanship.

Product Information
SKU SHP-RINGS0821187966
Width 6 mm
Height 8 mm
Weight 4.50 gm (Approximate)
Center Stone Weight 0.25 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-engagement-rings

FAQs About: Natural Aquamarine Flower Inspired Engagement Ring With Diamond

What is a flower inspired engagement ring?
A flower inspired engagement ring uses design elements that resemble petals or floral patterns to create a decorative setting around the center gemstone.
What makes aquamarine popular in engagement rings?
Aquamarine is valued for its light blue color and transparent clarity, offering a distinctive and elegant alternative to traditional engagement ring gemstones.
What do diamond accents add to an engagement ring?
Diamond accents add brightness and sparkle to a ring design while helping highlight the central gemstone.
Are aquamarine rings suitable for engagement?
Aquamarine rings are commonly selected for engagement jewelry due to their elegant color and distinctive appearance.
What style does a floral ring design represent?
Floral ring designs often reflect nature-inspired aesthetics that incorporate petal shapes and organic motifs within the setting.
Can aquamarine engagement rings be paired with wedding bands?
Aquamarine engagement rings can generally be paired with various wedding band styles depending on the ring design and band shape.