Diamond Wine Glass Earring for Tragus Piercing

Regular price $1,023.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Playful Diamond Wine Glass Tragus Earring

This Diamond Wine Glass Earring for Tragus Piercing blends creative design with refined craftsmanship. The earring features a wine glass silhouette accented with diamonds, creating a distinctive and playful jewelry piece designed specifically for cartilage piercings.

Its compact structure and unique motif make it a stylish accent for curated ear looks, adding personality while maintaining the elegance associated with fine jewelry.

Designed for Tragus and Cartilage Piercings

Jewelry designed for tragus piercings must balance visual appeal with a compact profile. This earring’s small and detailed design allows it to sit comfortably within cartilage piercings while remaining visually noticeable.

The wine glass motif offers a creative interpretation of everyday inspiration, making it an interesting addition to modern ear styling.

Diamond Detail in a Minimal Form

Diamonds are used in jewelry for their brilliance and durability. Their natural sparkle adds refined contrast to the design, allowing even a small piece of jewelry to stand out.

In this earring, the diamonds highlight the shape of the wine glass motif, enhancing its visual definition while maintaining a delicate appearance.

A Unique Accent for Curated Ear Styling

Cartilage jewelry has become an important part of modern personal style, allowing individuals to mix and match multiple earrings for a layered ear look. Unique shapes and motifs can bring individuality to these combinations.

This diamond wine glass tragus earring offers a creative and elegant option for those looking to add character to their ear jewelry collection.

Product Information
SKU SHP-BODYJ102310061
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.04 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1X1 mm-1 Pcs
Round-0.90X0.90 mm-2 Pcs
Round-0.80X0.80 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Diamond Wine Glass Earring for Tragus Piercing

What is a tragus earring?
A tragus earring is designed for the small cartilage area in front of the ear canal known as the tragus. These earrings are typically compact and comfortable for cartilage piercings.
Can this earring be worn in other cartilage piercings?
Many small cartilage earrings can be worn in different ear piercings depending on the jewelry size and personal styling preferences.
Why are diamonds used in cartilage earrings?
Diamonds are valued for their brilliance and durability. Even in small jewelry pieces, they add sparkle and enhance the overall design.
Is cartilage jewelry comfortable for everyday wear?
Cartilage jewelry designed with compact shapes and secure settings can be comfortable for daily wear once the piercing has healed.
What is curated ear styling?
Curated ear styling refers to combining multiple earrings across different ear piercings to create a personalized layered jewelry look.
Are novelty shaped earrings popular in cartilage jewelry?
Yes, creative motifs and small symbolic shapes are often used in cartilage jewelry to add personality and individuality to ear styling.