Diamond Swirl Stud Earring with Screw Back

Sale price $1,190.00 Regular price $1,368.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Refined Everyday Diamond Stud

The diamond swirl stud earring with screw back is designed for those who prefer subtle detail with dependable wear. The swirl motif creates a soft, flowing shape that frames the diamond accents while maintaining a compact, versatile profile.

Suitable for daily styling, this stud pairs easily with other earrings or can be worn alone for a clean, balanced look.

Swirl Design with Secure Setting

The swirl pattern introduces gentle movement into a classic stud format. Diamonds are set within the design to follow its natural curve, helping distribute light evenly across the surface.

The screw back closure is intended to provide a more secure fit compared to traditional push backs, supporting stable and comfortable wear when properly fastened.

Diamond Detail for Daily Wear

Diamonds are selected for their durability and lasting brilliance, making them suitable for everyday use when handled with appropriate care. Their natural hardness supports long-term wear in stud earring designs.

For complete information on stone specifications and metal options, please refer to the product detail tables provided on this page.

High-Level Features

  • Swirl-inspired stud design
  • Diamond accents for consistent sparkle
  • Screw back closure for added security
  • Suitable for everyday and occasion wear
Product Information
SKU SHP-EARRINGS062016320
Length 6.7 mm
Width 7 mm
Height 2.3 mm
Metal Weight 1.67 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Prong-Setting
Quality Grade SI
View More
Is this earring sold as a single piece or a pair?
Please review the product detail tables to confirm whether the listing is for a single earring or a pair, as this can vary by style.
What is the benefit of a screw back closure?
A screw back closure is designed to provide a more secure fit by fastening the back onto a threaded post, helping reduce the risk of accidental loss when properly secured.
Are diamond studs suitable for everyday wear?
Diamonds are durable gemstones and are commonly chosen for everyday jewelry. Proper care and secure fastening help maintain their condition over time.
Can this stud be worn in multiple piercings?
The suitability for different piercings depends on the earring’s size and post specifications. Please refer to the product detail tables for exact measurements before selecting placement.
Where can I find metal and stone specifications?
Complete information regarding metal options, dimensions, and diamond specifications is available in the product detail tables on this page.