Diamond Puzzle Piece Earring for Helix Piercing

Regular price $1,036.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Accent for Helix Piercings

The Diamond Puzzle Piece Earring for Helix Piercing is designed for those who value symbolism in fine jewelry. The puzzle piece motif represents connection and individuality, while its compact scale makes it suitable for cartilage styling.

Created specifically for helix placement, this piece offers a refined balance between visual detail and everyday practicality.

Design & Setting Structure

The puzzle piece silhouette is carefully formed to maintain clarity of shape at a smaller size. Diamonds are set to enhance light reflection without overwhelming the clean outline of the design.

The setting is structured to sit securely in a helix piercing. Details regarding metal options, dimensions, backing type, and stone specifications are provided in the product detail tables below.

Diamond Value & Wearability

Diamonds are appreciated for their durability and brilliance, making them suitable for regular wear when properly maintained. In smaller cartilage jewelry, precision setting is essential to both comfort and longevity.

Specific stone information and measurements, where applicable, are listed in the product tables on this page.

High-Level Features

  • Puzzle piece motif designed for helix piercings
  • Diamond accents for subtle brilliance
  • Compact scale suited to cartilage placement
  • Structured setting for secure, balanced wear
Product Information
SKU SHP-BODYJ122310046
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-2 Pcs
Round-1.25X1.25 mm-4 Pcs
Round-1.20X1.20 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More
Is this earring sold as a single piece or a pair?
The product listing specifies whether the item is sold individually or as a pair. Please refer to the product detail tables for confirmation.
Is this earring suitable for helix piercings?
This design is created for helix placement. For exact sizing and post details, review the specifications provided in the product tables.
What metal options are available?
Available metal types and finishes are listed in the product detail tables above.
Are diamonds durable enough for everyday wear?
Diamonds are known for their durability, making them suitable for regular wear when properly cared for and securely set.
How should I care for a helix earring with diamonds?
Clean gently with a soft cloth and mild solution. Periodic inspection can help ensure the setting remains secure over time.