Diamond Lotus Flower Necklace in Pave Setting

Regular price $2,209.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of nature-inspired elegance to your look with this stunning Diamond Lotus Necklace. The pendant features a delicate lotus flower design, expertly crafted in gleaming metal and encrusted with a sparkling Round Diamond in Pave Setting. This elegant Lotus Flower Necklace is perfect for adding a touch of sophistication and glamour to any outfit, and makes an ideal gift for someone special. This Diamond Lotus Floral Pendant Necklace is sure to captivate with its intricate design and timeless beauty. Let its shimmering diamonds and delicate floral motif elevate your style and make you feel like a true natural beauty. The simplicity of the Diamond Necklace for Women is punctuated with charm and serenity that radiates wherever you go. The luxury, drama and mystery of this Diamond Pendant Necklace is designed to evoke the spirit of the show in a fun and playful way. So, shimmer and sparkle just as the lotus comes up from the bud, which is pure when it opens. Symbolizing enlightenment and determination, this Real Diamond Necklace combines the timeless beauty of the lotus flower with the captivating beauty of Natural Diamond.

Product Information
SKU SHP-PENDANT082210264
Metal Weight 3.22 gm (Approximate)
Total Stone Weight 0.44 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 48 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-4 Pcs
Round-1.10X1.10 mm-34 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces