Diamond Lotus Earring for Helix Piercing

Regular price $1,055.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Floral inspired piercing earrings have become extremely popular, and they are more fashionable than ever before. If you are searching for jewelry to enhance your look with a layered design, consider this Diamond Floral Earring. This beautiful earring features a sparkling round diamond set in bezel setting set in a gold flower motif. Now, imagine the beauty of a flower earring designed to be a fit for your Helix, Cartilage, or Upper Lobe Piercing. This exquisite piece of jewelry can be the start of a collection of piercing earrings.

Product Information
SKU SHP-BODYJ022410051
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.07 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More