Diamond Key To My Heart Necklace for Women

Sale price $1,965.00 Regular price $2,259.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for the person who feels like home, the Diamond Key To My Heart Necklace for Women turns a deeply romantic idea into a delicate keepsake. Its key-inspired pendant carries a heart-shaped head and a double-heart detail, creating a meaningful symbol of trust, affection, and the quiet promise of letting someone into your world. Round brilliant cut diamonds add a refined sparkle across the design, giving this necklace a graceful presence for anniversaries, birthdays, Valentine’s Day, or a heartfelt “just because” gift.

Natural Diamond Key To My Heart Necklace For Women

This diamond key necklace is crafted as a classic pendant with 32 round diamonds totaling approximately 0.31 carat. The stones are arranged in a prong setting to bring light and definition to the heart-and-key silhouette, while the design keeps the look romantic without feeling overly ornate. Available in 92.5 sterling silver as well as 10K, 14K, and 18K yellow or white gold options, it can be selected with an 18-inch chain or without a chain to suit the wearer’s style.

What Makes This Special

The design centers on a key motif with a heart-shaped head, making the necklace instantly personal and symbolic. A delicate double-heart accent softens the key silhouette and gives the pendant an affectionate, gift-ready character.

The diamond layout includes 32 round stones with an approximate total weight of 0.31 carat. The diamonds are brilliant cut and prong set, with HI color and SI quality for the natural diamond option, while the available lab diamond quality is EF-VS.

Metal choices include 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. The necklace can be ordered with an 18-inch chain or as a pendant without chain.

Why Choose This Design

A key necklace carries emotional depth without being too formal, making it an easy choice for romantic gifting, promise jewelry, or a meaningful milestone. The round brilliant cut diamonds bring a lively shimmer to the compact design, while the prong setting helps each stone stay visually distinct. Because the pendant has a slender profile and symbolic shape, it feels personal enough for special occasions yet versatile enough to wear with everyday outfits.

Design Meaning

The heart and key pairing speaks to love, trust, and emotional closeness. The key represents access, possibility, and the opening of a shared future, while the heart reflects affection and commitment. Together, the motif becomes a thoughtful way to say “you hold the key to my heart,” making this necklace especially meaningful for a partner, spouse, fiancée, or someone whose presence feels irreplaceable.

Authenticity & Craftsmanship

Rosec Jewels crafts this necklace with careful attention to the diamond arrangement, stone security, and refined finishing so the romantic key silhouette feels polished from every angle. The piece comes with a Certificate of Authenticity for added purchase confidence. Before dispatch, each necklace goes through stone inspection, setting security review, and finishing inspection, with care guidance offered to help preserve its shine and detailing over time.

Style and Wearability

This heart key necklace rests close to the neckline when selected with the 18-inch chain, giving it a soft sparkle that layers well with fine chains and other pendants. Worn alone, it feels intimate and meaningful; paired with other jewelry, it adds a romantic focal point without overwhelming the look. Its available metal choices make it easy to match with warm yellow gold styling, cool white gold jewelry, or the clean brightness of sterling silver.

Product Information
SKU SHP-PENDANT032210231
Weight 3.30 gm (Approximate)
Center Stone Weight 0.31 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 32 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-28 Pcs
Round-1.20X1.20 mm-1 Pcs
Round-1X1 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
april-birthstone-jewelry

FAQs About: Diamond Key To My Heart Necklace for Women

What makes this diamond key necklace a meaningful gift?

The necklace combines a key motif with a heart-shaped head and double-heart detail, making it a romantic symbol of trust, love, and emotional closeness. It is well suited for anniversaries, Valentine’s Day, birthdays, commitment gifts, or a personal surprise for someone special.

What does the heart and key design symbolize?

The key represents access, possibility, and the idea of opening one’s world to another person, while the heart reflects affection and commitment. Together, the design expresses the sentiment of giving someone the key to your heart.

What diamonds are used in this necklace?

This heart key necklace is set with 32 round brilliant cut diamonds totaling approximately 0.31 carat. The natural diamond option has HI color and SI quality, while the lab diamond option is offered in EF-VS quality.

How are the diamonds set in the pendant?

The round diamonds are placed in a prong setting, which helps define the heart key silhouette while allowing the stones to catch light across the pendant.

Which metal options are available for this necklace?

The key necklace is available in 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Does the necklace come with a chain?

The design can be selected with an 18-inch chain or without a chain, giving buyers the option to wear it as a complete necklace or pair the pendant with a chain they already own.

How should I care for this diamond key necklace?

Store the necklace separately in a soft jewelry pouch or box, keep it away from harsh chemicals, and gently clean it with a soft cloth after wear. Rosec Jewels also includes a Certificate of Authenticity and provides care guidance to support long-term product confidence.