Diamond Heart Earring for Helix Piercing

Regular price $1,059.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Subtle Heart for Cartilage Styling

This Diamond Heart Earring for Helix Piercing is created for those who prefer refined sparkle in a compact, symbolic form. The heart silhouette offers a soft, meaningful detail while remaining minimal enough for curated ear arrangements.

Its scale and structure are intended to complement helix placement without overpowering surrounding jewelry.

Heart Design with Fine Detailing

The heart motif represents affection and personal expression. Crafted in a clean outline, it delivers visual clarity and balanced proportions suited for cartilage wear.

The diamond placement enhances the heart’s contours, adding light reflection while maintaining a delicate appearance.

Diamond Brilliance for Everyday Elegance

Diamonds are valued for their durability and light performance, making them a considered choice for fine jewelry worn regularly. In this helix earring, the diamond accent introduces crisp sparkle while preserving a lightweight aesthetic.

With proper care and routine cleaning, the brilliance remains consistent over time.

High-Level Features

This helix earring features a heart-shaped design accented with diamond detail. It is intended for cartilage styling, offering a balance of symbolism, refined sparkle, and minimal structure suitable for layered ear looks.

Product Information
SKU SHP-BODYJ102310058
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.10 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1X1 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Diamond Heart Earring For Helix Piercing

Is this earring suitable specifically for helix piercings?
Yes, the design and proportions are intended for helix placement, making it appropriate for cartilage wear.
Is this heart helix earring sold individually?
Please refer to the product detail table to confirm whether it is offered as a single piece or as a pair.
Can I wear this diamond heart with other ear piercings?
Yes, its compact heart shape makes it easy to coordinate with studs, hoops, or additional cartilage jewelry in a layered ear look.
Are diamonds durable for cartilage jewelry?
Diamonds are known for their hardness and are commonly used in fine jewelry, including pieces designed for cartilage placement.
How should I maintain the sparkle of this helix earring?
Clean gently with mild soap and lukewarm water using a soft brush or cloth, then dry thoroughly before storing or wearing again.