Diamond Cherry Fruit Earring for Helix Piercing

Regular price $1,058.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Playful, polished, and made for a curated ear with personality, this diamond cherry fruit earring brings a sweet sparkle accent to helix and upper ear styling. The design is shaped with two cherry motifs, round diamonds, and accent leaves, creating a tiny fruit-inspired statement that feels joyful without losing its refined jewelry finish. Sold singly, it is perfect for styling one piercing, building an asymmetric ear stack, or gifting a bright little detail for a birthday, celebration, or personal milestone.

Helix Piercing with Diamond Cherry Fruit Earring

This cherry-inspired helix earring is crafted with 10 round diamonds in a prong setting, arranged to create the fruit and leaf details of the design. The diamonds are brilliant cut, HI in color, and SI in quality grade, with an approximate total diamond weight of 0.04 carat. Available with lab diamond EF-VS or natural diamond HI-SI gemstone quality selections, plus multiple gold options and flat back post lengths, it brings a fun yet refined diamond accent to body jewelry styling.

What Makes This Special

The earring features 10 round diamonds with an approximate total weight of 0.04 carat. The diamond arrangement includes 6 round stones measuring approximately 0.80 x 0.80 mm, 2 round stones measuring approximately 0.90 x 0.90 mm, and 2 round stones measuring approximately 1 x 1 mm.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and secured in prong settings. The cherry fruit design is accented with leaf details, giving the earring a playful silhouette while keeping the sparkle delicate and wearable.

The earring has an approximate weight of 0.90 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

Fruit-inspired body jewelry gives a curated ear a sense of charm and individuality, and the cherry motif makes this piece feel especially fresh. The small round diamonds create gentle sparkle across the design, while the leaf accents add shape and character so the earring feels more expressive than a simple stud.

The prong setting keeps the diamonds visible and defined, helping the tiny stones catch light within the playful form. The flat back post options support comfortable placement for helix and upper ear piercings, making this helix earring a thoughtful choice for daily styling, stacked looks, or a gift with a cheerful personality.

Design Meaning

Cherry jewelry often carries a feeling of sweetness, joy, youthfulness, and playful confidence. In this design, the diamond cherries and accent leaves create a symbol of fresh energy and self-expression. It can mark a birthday, a new piercing, a personal style shift, or a small celebration of feeling bright, bold, and fully yourself.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, cherry and leaf detailing, prong setting security, smooth flat back finishing, and comfortable proportions. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This diamond cherry earring adds a bright, whimsical accent to helix, cartilage, and upper ear styling. Worn alone, it becomes a tiny statement with personality; paired with diamond studs, gold hoops, flat backs, or fruit and floral motifs, it helps build a curated ear that feels playful and intentional. Its single-piece format makes it ideal for asymmetric styling, while the gold options allow the design to blend naturally with warm or cool jewelry stacks.

Product Information
SKU SHP-BODYJ122310005
Weight 0.90 gm (Approximate)
Center Stone Weight 0.04 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-6 Pcs
Round-0.90X0.90 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Cherry Fruit Earring for Helix Piercing

What makes this diamond cherry earring suitable for helix piercing?

The earring has a compact cherry fruit design with a flat back post option, making it suitable for helix and upper ear styling. Its single-piece format also makes it easy to create an intentional asymmetric or curated ear look.

How many diamonds are used in this cherry fruit earring?

The earring includes 10 round diamonds with an approximate total weight of 0.04 carat. The layout includes 6 round diamonds measuring approximately 0.80 x 0.80 mm, 2 round diamonds measuring approximately 0.90 x 0.90 mm, and 2 round diamonds measuring approximately 1 x 1 mm.

What cut and setting style are used for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are secured in prong settings, which help define the cherry and leaf details while keeping the stones visually open.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, allowing buyers to style one piercing, highlight one side, or build an asymmetric ear stack.

What gemstone quality options are available?

The earring offers lab diamond EF-VS and natural diamond HI-SI gemstone quality selections. The diamond information also lists round brilliant diamonds with HI color and SI quality grade.

What metal options are available for this earring?

This design is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, giving buyers warm and cool precious metal choices for their piercing stack.

How should I care for this diamond cherry helix earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry it carefully before storing.