Designer Freshwater Pearl Bridal Drop Earrings with Diamond

Regular price $3,502.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the timeless charm of celestial elegance with these Pearl Drop Earrings. Each earring features a luminous 9X12 mm Freshwater Pearl that delicately hangs from a beautifully crafted crescent-moon–inspired design, sparkling with petite Diamond stones that add just the right touch of brilliance. The blend of the moonlit motif and the soft glow of the Pearl creates a dreamy, romantic look, perfect for brides who want something meaningful, stylish and effortlessly graceful. The Screw Back Closure ensures a secure and comfortable fit, so you can enjoy every moment of your celebration without worry. Whether you are walking down the aisle, capturing unforgettable moments or dancing the night away, these Pearl Diamond Earrings bring a refined shimmer that feels both modern and magical. Presented in an elegant jewelry box, these Pearl Earrings for Women make a thoughtful gift for a bride-to-be or anyone who adores jewelry with symbolic beauty. Created to be cherished long after the special day, this pair is a lovely reminder that elegance never goes out of style.

Product Information
SKU SHP-EARRINGS012210279
Length 32 mm
Width 14.8 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 12.70 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 12.00 Carat (Approximate)
Dimension(approx) Drops-9X12 mm-2 Pcs
Color White
Cut Brilliant
Shape Drops
Setting Type Pave-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 56 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-1.40X1.40 mm-50 Pcs
Round-1.60X1.60 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings