Designer Ethiopian Opal Heart Engagement Ring with Diamond Split Shank

Regular price $2,716.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Designer Ethiopian Opal Heart Engagement Ring with Diamond Split Shank is created for those who value symbolism and individuality in equal measure. The heart-shaped opal serves as a meaningful centerpiece, reflecting emotion and commitment, while its natural play of color brings a luminous, ever-changing character to the design. It is a distinctive choice for a proposal that feels personal and expressive.

Split Shank with Refined Diamond Detail

The split shank design gently separates as it approaches the center stone, adding dimension and architectural balance to the ring. Diamond accents along the shank enhance light reflection and frame the opal without overpowering it. This structure not only elevates the visual presence of the heart-shaped center but also creates an elegant, well-proportioned silhouette on the finger.

The Beauty of Ethiopian Opal

Ethiopian opal is admired for its vibrant flashes of color that shift with movement and light. Each stone displays a unique pattern, ensuring that no two rings are exactly alike. With mindful care, opal can be enjoyed as a meaningful engagement gemstone, appreciated for its individuality and luminous character.

Designed for Meaningful Commitment

The combination of a heart motif, radiant opal center, and diamond-accented split shank makes this ring suitable for those seeking an engagement style that stands apart from traditional choices. It can be worn alone as a statement of commitment or paired with complementary bands for a layered bridal look. The overall design emphasizes emotion, artistry, and thoughtful craftsmanship.

Product Information
SKU SHP-RINGS0821228655
Width 8.5 mm
Height 5 mm
Metal Weight 2.89 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 64 Pieces
Total Weight 0.33 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-56 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-engagement-rings

FAQs About: Designer Ethiopian Opal Heart Engagement Ring with Diamond Split Shank

Is opal suitable for an engagement ring?
Opal is chosen for its unique play of color and individuality. With proper care and mindful wear, it can be enjoyed as a meaningful engagement gemstone.
What does a split shank design offer?
A split shank adds dimension and visual balance to the ring by dividing the band as it approaches the center stone, enhancing both structure and style.
Is each Ethiopian opal the same?
No. Ethiopian opals naturally vary in their internal patterns and flashes of color, making each ring unique.
Can this ring be worn daily?
The ring can be worn regularly with mindful care. Removing it during activities that may cause impact helps preserve the opal and diamond accents.
How should I clean this opal engagement ring?
Clean gently with mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store separately to help maintain the gemstone and metal finish.