Dainty Diamond Star Earring for Tragus Piercing

Sale price $690.00 Regular price $793.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Diamond Star Earring is crafted with solid gold metal, and features a round diamond solitaire on a star motif.

  • Style this star celestial earring on your Helix, Cartilage, Tragus, Conch, or Upper Lobe Piercing. The flat back closure will keep it intact in place.
  • You can don this star celestial earring with your favorite attires, to stand out from the crowd. Its hard to resist the allure of our star earring, giving off more sparkle.
  • Surprise your special one with this diamond piercing earring on any occasion to make her fall in love with you all over again.
Product Information
SKU SHP-BODYJ082410096
Length 5 mm
Width 5 mm
Height 1.7 mm
Metal Weight 0.40 gm (Approximate)
Total Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More