Cute Diamond Love Heart Earring for Helix Piercing

Regular price $1,074.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Are you feeling the love? Dress up with this Diamond Love Heart Earring. This earring showcases dainty Round Diamonds secured by pave setting on the border of the heart motif.

  • You can wear this Diamond Heart Earring on your multiple piercings like Helix, Cartilage, or Upper Lobe Piercing.
  • Stack this Cute Diamond Earring with your other pieces of piercing jewelry. This Earring will instantly add a pop of sparkle to any outfit.
  • Surprise your special one by getting this Piercing Earring for her as a Birthday, Anniversary, Christmas, or Valentines Day Gift, shell surely adore it for her whole life!
Product Information
SKU SHP-BODYJ082410060
Length 6.7 mm
Width 6.7 mm
Height 2.2 mm
Metal Weight 0.87 gm (Approximate)
Total Stone Weight 0.08 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-16 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More