Cushion Cut Created Ruby Solitaire Infinity Pendant with Diamond

Sale price $2,276.00 Regular price $2,616.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Pendant with Balanced Form

This infinity pendant is designed for those who appreciate meaningful symbolism combined with structured elegance. The flowing infinity motif creates a continuous form, offering a sense of balance and connection.

Paired with a defined center stone, the design achieves a refined presence suitable for both everyday styling and special occasions.

Infinity Setting with Diamond Detail

The infinity structure frames the center stone while introducing a smooth, continuous curve. Diamond accents are incorporated to enhance light reflection, adding subtle brilliance without overwhelming the design.

This arrangement provides both visual flow and structural stability, maintaining a cohesive appearance.

Created Ruby with Consistent Tone

The cushion cut created ruby offers a uniform and rich color, adding depth to the pendant. It is created without traditional mining, with impact varying by production and energy source.

Its composition makes it suitable for regular wear when handled with proper care.

Designed for Versatile Wear

This pendant is suited for those seeking a piece that adapts across different settings. Its balanced proportions allow it to pair well with both minimal and layered jewelry styles.

With its combination of symbolic design and structured detailing, it offers a reliable option for long-term use.

Product Information
SKU SHP-PENDANT042159671
Length 21 mm
Width 8.8 mm
Weight 3.02 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Cushion
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-necklace

FAQs About: Cushion Cut Created Ruby Solitaire Infinity Pendant with Diamond

What does an infinity pendant symbolize?
An infinity pendant represents continuity and lasting connection, making it a meaningful design choice.
Is this pendant suitable for everyday wear?
The design and materials make it suitable for regular wear, though proper care helps maintain its appearance.
What is the benefit of a cushion cut ruby?
Cushion cuts provide a soft, rounded appearance with balanced light reflection, enhancing the overall look of the stone.
Do diamond accents enhance the design?
Diamond accents add brightness and help balance the pendant by enhancing light reflection.
Will the ruby maintain its color over time?
Created rubies are designed to retain their color, and proper care helps preserve their appearance.
How should I care for this pendant?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to maintain its finish and clarity.