Cultured Freshwater Pearl Promise Ring with Diamond Leaf

Sale price $1,823.00 Regular price $2,048.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Confess your love in the most graceful way with this Pearl Promise Ring, designed to capture both the beauty of nature and heartfelt emotion. At its center rests a 5 mm Freshwater Pearl, glowing with a soft charm that symbolizes purity, honesty and the beginning of something meaningful. Placed in an elegant open leaf motif, gently detailed with sparkling Diamond stones, representing growth, renewal and a bond that continues to flourish over time. The nature inspired design adds a poetic touch, reminding you of a connection that grows naturally, just like leaves reaching toward the light. This Pearl Diamond Ring is a symbol of promises made with sincerity and a future built together step by step. Perfect as a promise ring, a romantic gift or a token to mark a special milestone, this Natural Inspired Ring comes beautifully presented in a signature jewelry box with various ring sizes to choose from. This Leaf Ring is a gentle expression of devotion, made to celebrate a love that continues to grow stronger and more beautiful with time.

Product Information
SKU SHP-RINGS032210331
Width 9 mm
Height 6.5 mm
Metal Weight 2.00 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-22 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
pearl-engagement-rings