Cultured 3 Carat Freshwater Pearl Flower Ring with Amethyst

Regular price $2,094.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Fill your moments with grace and charm with this beautifully designed Pearl Amethyst Ring, a piece that captures the romance of nature. On one end rests a luminous 7 mm Freshwater Pearl, symbolizing purity, wisdom and timeless elegance, while the other end blooms into a Flower motif set with a 3 mm Round Amethyst at its heart. The Amethyst adds a soft touch of purple, representing love, peace and a deep emotional connection. The wrap style design gently curves around the finger, symbolizing two individuals coming together in harmony. This open and flowing style gives the ring a modern yet meaningful look, making it stand out with subtle beauty. Perfect as a promise ring, a thoughtful gift or a piece to celebrate a special moment, this Wrap Engagement Ring carries a message of balance, love and new beginnings. Easy to style and comfortable to wear, this Pearl Engagement Ring adds a fresh, elegant touch to both everyday outfits and occasion wear. Presented in a signature jewelry box and available in various ring sizes, this Flower Engagement Ring is ready to become a cherished keepsake. Romantic and full of meaning, this ring is a lovely expression of love that continues to bloom.

Product Information
SKU SHP-RINGS0821211166
Width 7 mm
Height 15.4 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 3.10 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 3.00 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
amethyst-rings