Cubic Zirconia Aquarius Zodiac Signet Ring

0
Regular price $3,033.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Aquarius Zodiac Signet Ring

The Cubic Zirconia Aquarius Zodiac Signet Ring brings together symbolic meaning and refined jewelry design. The ring features the Aquarius zodiac motif set within a classic signet style, creating a distinctive piece that represents individuality and personal expression. Its balanced form and polished surface give the ring a bold yet elegant presence.

Signet Ring Design

Signet rings are traditionally recognized for their flat or slightly raised face that displays a symbol, engraving, or motif. In this design, the Aquarius zodiac emblem becomes the focal point, offering a meaningful detail that reflects the wearer’s astrological identity. The structured shape of the signet ring provides a timeless appearance suited to both modern and classic jewelry styles.

Cubic Zirconia Accents

Cubic zirconia gemstones are known for their bright sparkle and clarity. Their reflective properties add brilliance to jewelry designs while complementing engraved or symbolic elements. The cubic zirconia accents in this ring enhance the visual contrast and bring subtle shine to the overall design.

A Symbolic Personal Jewelry Piece

This zodiac signet ring combines personal symbolism with refined craftsmanship. The Aquarius motif paired with sparkling accents creates a ring that reflects individuality while maintaining a clean and timeless aesthetic suitable for everyday styling.

Product Information
SKU SHP-RINGS042210300
Weight 4.00 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 30 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-20 Pcs
Round-1X1 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave Setting
Quality Grade AAAA

View More

 

Product Parent Collection Handle
aquarius-zodiac-sign-jewelry

FAQs About: Cubic Zirconia Aquarius Zodiac Signet Ring

What is a zodiac signet ring?
A zodiac signet ring features an astrological symbol or motif on the face of the ring, representing the wearer’s zodiac sign.
What does the Aquarius zodiac symbol represent?
Aquarius is traditionally associated with creativity, independence, and forward-thinking qualities in astrology.
What is cubic zirconia in jewelry?
Cubic zirconia is a gemstone known for its clarity and bright sparkle, often used in jewelry to provide brilliance similar to diamond-like stones.
What is a signet ring style?
A signet ring is a ring design with a flat or raised surface that traditionally carries a symbol, emblem, or engraved design.
How should a cubic zirconia ring be cleaned?
Clean the ring using warm water, mild soap, and a soft cloth or brush. Rinse carefully and dry gently to maintain its sparkle.