Contemporary Diamond Braided Twist Pendant Necklace

Sale price $1,938.00 Regular price $2,228.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Bring a clean, modern accent to everyday jewelry with this Diamond Contemporary Pendant Necklace. Its diamond-set bar-inspired design balances refined sparkle with a streamlined silhouette, making it easy to wear beyond special occasions. Whether chosen as a personal signature piece, anniversary present, birthday gift, or thoughtful jewelry surprise, this contemporary diamond necklace offers understated brilliance with a distinctly modern character.

Contemporary Diamond Bar Pendant Necklace in Precious Metal Options

The design belongs to Rosec Jewels' bar necklace collection and centers on diamond detailing within a contemporary pendant profile. Confirmed metal choices include 92.5 Sterling Silver, 10K White Gold, 10K Yellow Gold, 14K White Gold, 14K Yellow Gold, 18K White Gold, and 18K Yellow Gold, with additional options also offered.

Diamond Bar Pendant Details for Modern Styling

  • Contemporary pendant necklace design
  • Diamond as the featured gemstone
  • Bar-inspired necklace style
  • 92.5 Sterling Silver option
  • 10K White Gold and 10K Yellow Gold options
  • 14K White Gold and 14K Yellow Gold options
  • 18K White Gold and 18K Yellow Gold options
  • Additional precious metal choices available

The linear bar-inspired format keeps the design visually clean, allowing the diamond detail to add light without making the necklace feel overly ornate.

Why Choose a Contemporary Diamond Bar Necklace

A bar pendant offers a modern alternative to traditional solitaire or motif necklaces. Its streamlined form can represent balance, direction, and personal progress, giving the piece added meaning for birthdays, graduations, anniversaries, career milestones, or simply marking a new chapter. Diamond detailing adds a lasting sense of occasion while the contemporary profile keeps the necklace versatile enough for regular wear.

Diamond Pendant Craftsmanship & Authenticity

Rosec Jewels emphasizes careful craftsmanship and certification across its diamond jewelry collection. This pendant is finished with attention to stone placement, setting security, and overall refinement, with each piece going through stone inspection, setting security review, and finishing inspection before dispatch. Rosec Jewels also provides certification with its jewelry for added purchase confidence. To preserve the necklace, clean it gently, avoid harsh chemicals and strong impact, and store it separately when not worn.

Styling a Contemporary Diamond Pendant Necklace

The streamlined diamond pendant can sit comfortably at the center of a minimal jewelry look or be layered with other fine necklaces for added dimension. White-metal options create a cool, crisp finish, while yellow gold choices introduce warmer contrast. Its contemporary bar styling works with everyday outfits, office wear, evening looks, and gifting occasions without relying on an overly formal design.

Product Information
SKU SHP-PENDANT082210154
Metal Weight 3.40 gm (Approximate)
Total Stone Weight 0.26 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 15 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-6 Pcs
Round-1.30X1.30 mm-3 Pcs
Round-1.50X1.50 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
bar-necklaces

FAQs About: Diamond Contemporary Pendant Necklace

What style is the Diamond Contemporary Pendant Necklace?

It is a contemporary diamond pendant necklace offered within Rosec Jewels' bar necklace collection, giving it a streamlined, modern jewelry profile.

What gemstone is used in this contemporary pendant necklace?

Diamond is the featured gemstone in this contemporary pendant necklace, adding brightness to its modern bar-inspired design.

What metal options are available for the diamond pendant necklace?

Confirmed options include 92.5 Sterling Silver, 10K White Gold, 10K Yellow Gold, 14K White Gold, 14K Yellow Gold, 18K White Gold, and 18K Yellow Gold. Additional metal choices are also offered.

Is this diamond bar pendant suitable for everyday styling?

Yes. Its streamlined contemporary profile makes it easy to style with casual clothing, workwear, and evening outfits. It can be worn alone for a clean look or layered with other necklaces.

Is a contemporary diamond necklace suitable for gifting?

Yes. The modern diamond design makes it suitable for birthdays, anniversaries, graduations, milestone celebrations, and other meaningful gifting occasions.

Does Rosec Jewels provide certification with its diamond jewelry?

Yes. Rosec Jewels states that it offers valid certification with its jewelry, providing additional confidence when purchasing diamond pieces.

How should I care for a diamond contemporary pendant necklace?

Clean the necklace gently with jewelry-appropriate methods, avoid harsh chemicals and strong impact, and store it separately when not worn. Periodic inspection of the diamond setting can also help maintain the piece during frequent wear.