Certified Round Lab Grown Diamond Designer Pendant Necklace

Sale price $1,914.00 Regular price $2,200.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Adorn your neckline by wearing this Minimal Diamond Pendant Necklace. This captivating Teardrop Pendant Necklace is adorned with a 6 mm Round Shape Diamond of Ef-Vs quality set in prong setting in the center, the Drop Pendant is further beautified with dainty lab grown diamonds and features a delicate leaf motif. The minimalist design exudes timeless charm, making this April Birthstone Necklace a versatile accessory for any occasion like - anniversaries, birthdays, and Valentines Day. Elevate your look with this enchanting Man Made Diamond Necklace from Rosec Jewels, where sophistication meets conscience.

Product Information
SKU SHP-PENDANT122310152
Metal Weight 2.78 gm (Approximate)
Total Stone Weight 1.10 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 1.10 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-7 Pcs
Round-1.20X1.20 mm-9 Pcs
Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More