Certified Real Oval Garnet Diamond Eternity Ring

Regular price $4,077.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Symbolizing endless affection in the sweetest way, this Full Eternity Ring captures the warmth of love in every shimmering detail. Each 3X5 mm Oval Shape Garnet is paired with an elegant X motif topped with dainty Diamond stones, forming a charming XOXO pattern that feels like a circle of hugs and kisses wrapped around your finger. The design is playful yet deeply romantic, blending rich color with sparkling brilliance to create a look that feels both modern and timeless. Every Red Garnet of AAA Quality glows with passion, while the HI-SI Quality Diamond stones add a gentle light. Perfect for anniversaries or any special moment, this Garnet Diamond Ring becomes a lasting reminder of the love you hold close. Whether worn daily or saved for meaningful occasions, this Garnet Eternity Band brings a tender sparkle to every gesture. Presented in a signature jewelry box and available in various ring sizes, this Red Garnet Ring arrives ready to gift and ready to make hearts flutter.

Product Information
SKU SHP-RINGS032219728
Metal Weight 2.96 gm (Approximate)
Total Stone Weight 4.28 Carat (Approximate)
GARNET INFORMATION
No.of Stones 9 Pieces
Total Weight 3.15 Carat (Approximate)
Dimension(approx) Oval-3X5 mm-9 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 45 Pieces
Total Weight 1.12 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-45 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
garnet-rings