Certified Real Garnet Diamond Heart Eternity Ring for Anniversary

Sale price $2,071.00 Regular price $2,327.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Certified Real Garnet Diamond Heart Eternity Ring for Anniversary is made for the kind of love that deserves to be seen, remembered, and worn close every day. Three round red garnet stones create a rich, romantic glow across the half eternity band, while tilted heart motifs set with dainty diamonds add a tender sparkle between each deep red gem.

This garnet and diamond ring is designed for anniversaries, meaningful milestones, January birthstone gifting, or a promise that continues to grow with time. Its alternating pattern of garnet and diamond-set hearts gives the ring emotion, rhythm, and a graceful sense of celebration, making it a piece that feels personal rather than ordinary.

Certified Real Garnet Diamond Heart Eternity Ring

This half eternity anniversary ring features 3 round brilliant cut red garnet stones totaling approximately 1.02 carats, paired with 12 round brilliant cut diamonds totaling approximately 0.36 carat. The garnets and diamonds are arranged in prong settings, with tilted heart motifs adding a romantic accent to the band. Available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, the ring can be chosen in the metal tone that best suits the wearer’s style.

What Makes This Special

  • Half eternity ring design created for anniversaries, milestones, and meaningful gifting.
  • Features 3 round red garnet stones as the main gemstones.
  • Garnets measure approximately 4X4 mm each and total approximately 1.02 carats.
  • Garnets are listed as AAA quality grade with brilliant cut detailing.
  • Designed with tilted heart motifs set with 12 round diamond accents.
  • Diamond accents measure approximately 1.70X1.70 mm each and total approximately 0.36 carat.
  • Diamonds are listed as HI color and SI quality grade with brilliant cut detailing.
  • Garnets and diamonds are arranged in prong settings for visible color and sparkle.
  • Approximate ring weight is 2.70 gm.
  • Presented as certified jewelry, made with precious metal only, checked by hand, and packaged in a signature jewelry box.

Why Choose This Design

The round garnets bring a deep red color that immediately connects the ring to love, devotion, and heartfelt celebration. Their 4 mm size gives the band a noticeable gemstone presence while keeping the ring comfortable and wearable for regular styling.

The diamond-set tilted hearts make this design especially meaningful for an anniversary. Instead of a plain gemstone band, the alternating heart motif adds emotion and movement across the ring, while the diamonds bring bright contrast against the red garnets. The half eternity layout gives the look of continuous love across the top of the finger, making it both symbolic and easy to wear.

Design Meaning

Garnet is often connected with passion, loyalty, protection, and lasting affection, making it a powerful choice for an anniversary ring or January birthstone gift. In this design, the red garnets represent the warmth and strength of a bond that has grown through shared moments.

The tilted heart motifs add a direct symbol of love, while the diamond accents bring light to that sentiment. Together, the garnets, hearts, and diamonds create a ring that speaks to devotion, treasured memories, and a relationship that continues to feel alive with meaning.

Authenticity & Craftsmanship

This ring is presented as certified jewelry and checked by hand. The visible specifications list 3 AAA quality garnets and 12 HI-SI diamonds, with details including approximate stone weights, dimensions, colors, cuts, shapes, setting type, SKU, and approximate ring weight.

The ring is made to order and crafted in precious metal options, allowing the buyer to choose a finish that complements the red garnets and diamond-set hearts. Each stone is arranged in a prong setting to keep the color and sparkle visible, while the signature jewelry box presentation makes the ring ready for gifting.

Style and Wearability

From the top, the ring shows a graceful alternation of red garnets and diamond heart motifs, creating a band that feels romantic without being overly large. Its half eternity structure keeps the decorative detail across the visible portion of the finger, making it comfortable for everyday wear while still special enough for anniversaries and celebrations.

White metal options create a crisp contrast with the red garnets and diamond accents, while yellow gold options add warmth and richness to the design. Wear it alone as an anniversary ring, stack it with slim bands, or gift it as a meaningful January birthstone piece for someone who loves sentimental jewelry with color and sparkle.

Product Information
SKU SHP-RINGS032219367
Weight 2.70 gm (Approximate)
Center Stone Weight 1.02 Carat (Approximate)
GARNET INFORMATION
No.of Stones 3 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-4X4 mm-3 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
garnet-women-wedding-bands

FAQs About: Certified Real Garnet Diamond Heart Eternity Ring for Anniversary

What makes this garnet diamond ring suitable for an anniversary gift?

This ring combines red garnet stones with diamond-set tilted heart motifs, making it a strong symbol of love, devotion, and shared memories. Its half eternity design also gives the ring a meaningful anniversary feel, representing love that continues forward.

What gemstones are used in this ring?

The ring features 3 round red garnet stones and 12 round diamond accents. The garnets measure approximately 4X4 mm each and total approximately 1.02 carats, while the diamonds measure approximately 1.70X1.70 mm each and total approximately 0.36 carat.

What quality grades are listed for the garnets and diamonds?

The garnets are AAA quality grade with brilliant cut detailing. The diamonds are HI color and SI quality grade, also with brilliant cut detailing.

What setting style is used for the garnet and diamond stones?

The garnet stones and diamond accents are arranged in prong settings. This setting style helps keep the red garnets and diamond-set heart motifs visible across the half eternity band.

What does the heart eternity design symbolize?

The heart motifs symbolize love, affection, and emotional connection, while the half eternity layout represents a bond that continues over time. Paired with red garnet, the design carries meaning of passion, loyalty, and lasting devotion.

What metal options are available for this garnet ring?

This ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These options allow buyers to choose a bright white metal finish or a warmer yellow gold tone.

How should I care for this garnet and diamond anniversary ring?

Clean the ring gently with mild soap, warm water, and a soft brush, then dry it with a lint-free cloth. Avoid harsh chemicals and remove the ring during heavy work or impact-prone activities. Store it separately in a jewelry box to help protect the garnets, diamonds, prong settings, and metal finish.