Certified Real Diamond Heart Earrings with Screw Back

Regular price $2,485.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Timeless Heart Design with Certified Diamonds

The Certified Real Diamond Heart Earrings with Screw Back are created for those who appreciate meaningful symbolism combined with secure craftsmanship. The heart silhouette reflects sentiment and affection, while the natural diamonds add refined brilliance suited for both everyday wear and special occasions.

Designed as a pair of stud earrings, this style balances emotional expression with practical construction. The inclusion of certification provides documented assurance regarding the authenticity and quality of the diamonds.

Design & Screw Back Security

The heart-shaped outline frames the diamonds in a structured and symmetrical form, offering a recognizable yet elegant profile. The screw back closure is designed to provide a more secure fit compared to standard push backs, helping the earrings remain comfortably in place during daily activities.

This combination of sentimental design and secure fastening makes the earrings suitable for long-term wear and gifting occasions.

Natural Diamond Value

Natural diamonds are valued for their durability and enduring sparkle. Their hardness supports regular wear in stud earrings, while certification offers transparency regarding key characteristics. With proper care, the diamonds maintain their brilliance over time.

High-Level Features

These heart earrings combine certified real diamonds, a secure screw back mechanism, and a timeless symbolic shape. The design emphasizes both emotional meaning and dependable wearability, making them appropriate for everyday styling or thoughtful gifts.

Product Information
SKU SHP-EARRINGS032155953
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 0.40 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 98 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-1X1 mm-2 Pcs
Round-0.90X0.90 mm-36 Pcs
Round-0.80X0.80 mm-60 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Certified Real Diamond Heart Earrings

What is the advantage of a screw back closure?
A screw back closure is designed to provide a more secure fit by fastening the backing firmly onto the post, helping reduce the chance of accidental loosening.
Are the diamonds in these heart earrings certified?
Yes, the earrings include certified natural diamonds, offering documented confirmation of their authenticity and quality characteristics.
Are heart-shaped diamond studs suitable for daily wear?
The stud format and durable nature of natural diamonds make them appropriate for everyday wear when properly maintained.
Does the heart design affect how the earrings sit on the ear?
The heart silhouette is structured to sit evenly against the ear, offering a balanced and recognizable shape without excessive projection.
Can these earrings be given as a meaningful gift?
The heart motif is commonly associated with affection and sentiment, making these certified diamond earrings a thoughtful gift option for special occasions.