Certified Real Black Spinel Flower Engagement Ring with Diamond

Regular price $2,234.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Full in Bloom, this Flower Engagement Ring captures a love that feels deep and endlessly captivating. At its center is a striking 5 mm Round Shape Black Spinel, glowing with a mysterious charm and set within a delicate Rose Flower motif that symbolizes love in its most beautiful form. Each petal feels like a promise unfolding, while petite Diamond stones shimmer softly along the Curved band, catching the light with every movement. The contrast between the dark AAA Quality Black Spinel and sparkling HI-SI Quality Diamond stones creates a balance of passion and elegance, modern yet timeless. Designed for those who believe love should be expressive and unforgettable, this Black Spinel Engagement Ring speaks without words, telling a story of devotion that grows stronger each day. Its graceful design wraps comfortably around the finger, making this Black Spinel Diamond Ring perfect for everyday wear or meaningful moments worth remembering. Presented in a signature jewelry box and available in multiple ring sizes, it is a heartfelt symbol of forever. A romantic choice for engagements or celebrating a love that continues to bloom beautifully over time.

Product Information
SKU SHP-RINGS0821183093
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 0.68 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
black-spinel-engagement-rings