Certified Real Aquamarine Leaf Earrings with Diamond

Regular price $1,446.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a flair of nature inspired elegance and sparkle with these Leaf Earrings, where artistry meets timeless beauty. Each earring features a 4X6 mm Pear Shape Aquamarine gemstone, gently slanted over a delicate Leaf motif that is intricately adorned with sparkling Diamond stones, creating a harmonious balance between charm and luxury. The soft blue hue of the AAA Quality Aquamarine evokes calm, serenity and clarity, while the HI-SI Diamond stones catch the light with every movement, adding a subtle yet dazzling brilliance. Designed to celebrate both sophistication and individuality, these Aquamarine Diamond Earrings effortlessly elevate any ensemble, from elegant evening wear to a chic daytime look, making them perfect for every occasion. Presented in a signature jewelry box, these Aquamarine Stud Earrings make a meaningful gift for someone special or a treasured addition to your own collection. These Aquamarine Ear Studs are a statement of elegance, a touch of whimsy and a reminder of the natural beauty that surrounds us.

Product Information
SKU SHP-EARRINGS042157771
Length 11.3 mm
Width 5.5 mm
Metal Weight 1.25 gm (Approximate)
Total Stone Weight 0.84 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Pear-4X6 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-earrings