Certified Pear Shape Lab Grown Diamond Flower Pendant Necklace

Regular price $2,664.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Some jewelry pieces catch the eye, but this Diamond Flower Necklace will surely steal the heart. We curated this Statement Necklace for those who love natures beauty, it features a combination of pear shaped diamonds and sleek bars decorated with graduated round cut diamonds surrounding the dainty center stone in an alternative way to create a floral motif. This Lab Made Diamond Necklace blends natures charm with modern allure. This nature-inspired Floral Diamond Pendant is a piece of art, designed to turn heads.

Product Information
SKU SHP-PENDANT022510045
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 1.31 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 1.31 Carat (Approximate)
Dimension(approx) Pear-4X6 mm-3 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1.40X1.40 mm-3 Pcs
Round-1.60X1.60 mm-3 Pcs
Round-2.10X2.10 mm-1 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More