Certified Natural Emerald Flower Promise Ring with Certificate

Sale price $2,378.00 Regular price $2,613.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Promise her a love that blossoms forever with this enchanting Flower Promise Ring, a delicate masterpiece that captures the beauty of romance in full bloom. At the center of this floral design rests a vivid 5 mm Round Shape Emerald gemstone, glowing with lush green brilliance and symbolizing growth and devotion. The flower motif gently unfurls around the center stone, creating a stunning design that feels both feminine and timeless. Thoughtfully crafted to embody the poetry of nature, this Emerald Promise Ring is a keepsake of affection, a daily reminder of a bond that continues to flourish. Whether it is a heartfelt promise, a meaningful gift or a symbol of new beginnings, this Emerald Flower Ring speaks straight to the soul. Presented in a signature jewelry box and available in a range of ring sizes, this Emerald Ring for Women is ready to make any moment unforgettable.

Product Information
SKU SHP-RINGS082223745
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.50 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
emerald-engagement-rings