Certified Moissanite Wedding Band

Regular price $2,364.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created for a promise that deserves detail from every angle, this certified moissanite wedding band brings together fine sparkle and symbolic design in a refined band silhouette. Round brilliant moissanites are set in an alternate pattern with infinite-style metal accents, giving the ring a graceful rhythm across the finger. Its delicate yet distinctive look makes it a meaningful choice for a wedding band, anniversary ring, commitment gift, or a personal piece that celebrates lasting connection.

Certified Round Moissanite Wedding Band with Prong Setting

This moissanite band ring is crafted with white round brilliant stones in a secure prong setting. The design includes 124 moissanite stones with an approximate total weight of 1.17 carats, arranged with 112 round stones measuring approximately 1 x 1 mm and 12 round stones measuring approximately 2 x 2 mm. The D-VS1 quality grade gives the band a bright, clean look, while the minimal profile keeps the design polished and wearable.

What Makes This Special

The band blends moissanite sparkle with infinite-style metal detailing, creating an alternate pattern that feels romantic without becoming overly ornate. The round brilliant cut stones add lively reflection, while the prong setting gives each stone defined placement across the design.

Its approximate dimensions are 20.5 mm in length, 4.8 mm in width, and 1.6 mm in height, with an approximate product weight of 3.50 gm. These proportions give the band visible presence while maintaining a slim, comfortable feel for regular wear.

Available metal choices include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. Ring sizes range from US 3.0 to US 13.0, with a ring sizer option available for added fit confidence.

Why Choose This Design

The round brilliant cut is chosen for its crisp sparkle, making it well suited to a wedding band that should catch light with subtle movement throughout the day. The prong setting helps the moissanites remain visually open, enhancing their brightness while keeping the design structured and secure.

The infinite-style accents add more personality than a plain band while preserving a minimal, balanced appearance. This makes the ring easy to pair with an engagement ring, wear as a standalone wedding band, or stack with other fine bands for a layered anniversary look.

Design Meaning

The infinite-inspired elements speak to lasting love, continued devotion, and a bond that grows stronger over time. Set between the sparkle of white moissanites, the motif becomes a quiet symbol of commitment, making this band especially fitting for wedding vows, anniversary milestones, and meaningful promises. Its delicate pattern brings sentiment into the design without taking away from its clean, wearable character.

Authenticity & Craftsmanship

Each band is carefully crafted with attention to stone alignment, setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, giving added confidence to the purchase. Before dispatch, the ring goes through stone inspection, setting security review, and finishing inspection to help ensure the piece is ready for everyday wear or gifting. For lasting shine, store it separately, avoid harsh chemicals, and clean gently with a soft jewelry cloth as part of regular care.

Style and Wearability

This moissanite wedding band has a polished, low-profile feel that works beautifully for daily wear while still offering enough sparkle for special moments. The alternating moissanite and infinite-style detailing gives the band visual movement from the front and side, making it appealing as a wedding ring, anniversary band, promise ring, or stackable piece. Choose a white metal for a crisp, modern finish or a yellow gold option for a warmer expression of the same romantic design.

Product Information
SKU SHP-RINGS122035907
Length 20.5 mm
Width 4.8 mm
Height 1.6 mm
Weight 3.50 gm (Approximate)
Center Stone Weight 1.17 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 124 Pieces
Total Weight 1.17 Carat (Approximate)
Dimension(approx) Round-1X1 mm-112 Pcs
Round-2X2 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
wedding-rings

FAQs About: Certified Moissanite Wedding Band

What type of stones are used in this wedding band?

This wedding band is set with white moissanite stones. The design includes 124 round moissanites with an approximate total weight of 1.17 carats.

What cut and setting style does the band have?

The moissanites are round in shape with a brilliant cut. They are secured in a prong setting, which helps define each stone while allowing the sparkle to remain visible across the band.

What does the infinite-style design symbolize?

The infinite-style detailing represents lasting love, continuity, and commitment. This makes the band meaningful for wedding vows, anniversaries, promise moments, or a personal symbol of an enduring bond.

Which metal options are available for this moissanite band?

This band is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Is this band suitable for everyday wear?

Yes, the minimal band profile and approximate 1.6 mm height make it suitable for regular wear. Its prong-set moissanites add sparkle while the band remains comfortable enough for daily styling.

Does this certified moissanite wedding band come with authenticity support?

Yes, Rosec Jewels offers a Certificate of Authenticity with the product. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this moissanite wedding band?

Store the band separately, keep it away from harsh chemicals, and wipe it gently with a soft jewelry cloth after wear. Remove it before swimming, exercising, or applying lotions and perfumes to help preserve its finish and sparkle.