Certified Moissanite Turtle Shape Pendant Necklace

Regular price $2,466.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Pendant with Refined Detail

The certified moissanite turtle shape pendant necklace is designed for those who appreciate jewelry with meaning. The turtle motif is often associated with patience, resilience, and longevity, making this piece suitable for personal milestones or thoughtful gifts. Its balanced scale allows it to rest comfortably along the neckline, making it appropriate for both daily wear and occasional styling.

Design Approach & Setting

The turtle silhouette is carefully structured so the outline remains clearly defined while the moissanite accents enhance light reflection. The setting supports the stones securely while preserving the character of the motif. This design approach ensures the pendant feels intentional and composed rather than ornamental.

Certified Moissanite Characteristics

Crafted with certified moissanite, this pendant offers strong brilliance and durability suitable for regular wear. Moissanite is created without traditional mining, though impact varies by production and energy source. Its hardness and light performance make it a practical option for those seeking a bright gemstone alternative in a meaningful design.

High-Level Features

  • Turtle-shaped silhouette inspired by symbolic meaning.
  • Certified moissanite selected for brilliance and resilience.
  • Designed for comfortable everyday styling.
  • Available in multiple precious metal options.
Product Information
SKU SHP-PENDANT032214187
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 39 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-1 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.20X1.20 mm-29 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1X1 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Certified Moissanite Turtle Shape Pendant Necklace

Is the moissanite in this pendant certified?
Yes. The product is described as featuring certified moissanite. For documentation or grading specifics, please review the product information section provided on the page.
Is moissanite durable enough for everyday wear?
Moissanite is known for its durability and resistance to scratching, which makes it suitable for regular use when properly cared for.
What does the turtle shape represent?
The turtle is commonly associated with longevity, patience, and steady progress, making it a meaningful symbol for gifting or personal expression.
What metal options can I choose from?
Available metal options are listed in the product selection area and detailed in the product specification tables. Please refer to those sections for exact choices.
How should I clean and store this necklace?
Clean gently with mild soap and lukewarm water using a soft brush, then dry with a soft cloth. Store separately to help maintain its finish and reduce surface contact with other jewelry.
Is this pendant suitable as a gift?
The symbolic turtle design and versatile style make it appropriate for birthdays, anniversaries, and meaningful occasions.