Certified Moissanite Open Circle Jewelry Set

0
Regular price $3,519.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Certified Moissanite Open Circle Jewelry Set

This certified moissanite open circle jewelry set is designed for buyers who value a coordinated, streamlined look with subtle sophistication. The set’s open circle motif delivers a consistent visual theme that works together as a collection while remaining versatile enough for separate wear.

Its balanced proportions and clean styling are suitable for everyday wear as well as more refined occasions, making it an appealing choice for those who want a unified jewelry presentation with effortless versatility.

Design & Setting

The open circle design emphasizes shape and symmetry, allowing each piece within the set to maintain a cohesive appearance while remaining visually light. The setting supports the stones securely without adding bulk, preserving a clean silhouette that adapts across different personal styles and wardrobe choices.

This design approach balances aesthetic clarity with functional wearability, helping ensure that the set feels intentional and integrated without unnecessary embellishment.

Stone Value

The set features certified moissanite stones selected for their consistent sparkle and durability. Moissanite is created without traditional mining, and its overall impact varies by production and energy source. When cared for appropriately, moissanite offers resilience and visual longevity in jewelry intended for regular wear.

High-Level Features

  • Coordinated open circle design across multiple pieces
  • Certified moissanite stones for balanced sparkle
  • Designed for flexible styling and everyday wear
  • Sleek, contemporary proportions for unified wear
Product Information
SKU SHP-PENDANT072210115
Length 23 mm
Width 16 mm
Height 3 mm
Metal Weight 5.90 gm (Approximate)
Total Stone Weight 1.04 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 91 Pieces
Total Weight 1.04 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Round-2.50X2.50 mm-2 Pcs
Round-1.30X1.30 mm-32 Pcs
Round-0.90X0.90 mm-56 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces
What items are part of this jewelry set?
This jewelry set includes the coordinated pieces shown on the product page, sold together as a set.
Can the pieces be worn separately?
Yes, each piece is designed to be worn together as a complete set or individually for styling flexibility.
Is moissanite suitable for everyday wear?
Moissanite is known for its durability and is suitable for regular wear with appropriate care.
Does this design feel heavy when worn?
The open circle design is intended to feel lightweight and balanced for comfortable wear over time.
How should I care for this jewelry set?
Clean gently with a soft cloth and store each piece separately to help preserve finish and appearance.