Certified Moissanite Leaf Dangle Drop Earrings

Regular price $1,303.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Elegant Movement with Nature-Inspired Design

These certified moissanite leaf dangle drop earrings are designed for those who appreciate graceful motion paired with refined detailing. Inspired by organic leaf forms, the design offers a fluid silhouette that moves naturally, making it ideal for occasions where subtle statement pieces are preferred.

The elongated drop style enhances the neckline and frames the face, creating a balanced yet noticeable presence.

Leaf Motif with Structured Flow

The leaf-inspired structure introduces a sense of continuity and flow, allowing each element to connect seamlessly. This arrangement is not purely decorative—it is intended to create a visual rhythm that enhances the overall look when worn.

Compared to static stud styles, this design brings dimension and movement, making it suitable for both formal settings and elevated everyday wear.

Moissanite Brilliance for Visual Impact

Moissanite is selected for its consistent light reflection, helping the earrings catch and reflect light from different angles. This makes the design especially effective in drop styles, where movement naturally enhances brilliance.

It provides a reliable choice for those seeking a bright and polished appearance without compromising on wearability.

Balanced Wear with Lightweight Feel

Despite their length, these earrings are structured to maintain balance when worn. The design aims to distribute weight evenly, allowing for comfortable wear across extended periods.

This makes them suitable for events, celebrations, or occasions where jewelry is worn for longer durations.

A Statement with Subtle Sophistication

These earrings are designed for individuals who prefer statement pieces that remain refined rather than bold. The leaf motif introduces a natural aesthetic, while the drop format ensures a distinctive appearance.

They complement both contemporary and classic styling, making them a versatile addition to a curated jewelry collection.

Product Information
SKU SHP-EARRINGS082210600
Weight 1.20 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 28 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-10 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Illusion-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
dangle-earrings

Faq About: Certified Moissanite Leaf Dangle Drop Earrings

Are these earrings suitable for long wear?
Yes, they are designed with a balanced structure to support comfortable wear for extended periods.
Do dangle earrings feel heavy when worn?
These earrings are designed to distribute weight evenly, helping reduce the feeling of heaviness during use.
Is moissanite suitable for everyday earrings?
Moissanite is often chosen for its consistent brilliance and durability, making it a practical option for regular wear.
What occasions are these earrings best suited for?
Their design makes them suitable for special occasions, formal events, or styled everyday wear.
Do these earrings move when worn?
Yes, the drop design allows gentle movement, which enhances their overall visual appeal.
How should these earrings be cared for?
Regular cleaning and careful storage help maintain their shine and preserve the design over time.