Certified Moissanite Flower Promise Ring with Beaded Detail

0
Regular price $1,384.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Inspired Promise Ring

The Certified Moissanite Flower Promise Ring with Beaded Detail captures the delicate beauty of floral design in a meaningful piece of jewelry. The flower-inspired arrangement places the moissanite stones at the center of the design, creating a graceful focal point that reflects light with subtle brilliance. This ring is thoughtfully created for those who want a promise ring that feels both symbolic and elegant.

Intricate Beaded Band Detail

The band features refined beaded detailing that adds texture and dimension to the design. These small decorative elements enhance the vintage-inspired character of the ring while maintaining a balanced and comfortable structure. The beaded accents complement the floral motif, bringing visual harmony to the entire piece.

Moissanite Brilliance

Moissanite is valued for its exceptional sparkle and clarity. Created without traditional mining, moissanite offers a gemstone alternative admired for its bright light performance. The environmental impact can vary depending on production methods and energy sources, but the gemstone remains widely appreciated for its brilliance and durability.

A Meaningful Everyday Symbol

This promise ring blends expressive design with refined craftsmanship, making it suitable for marking meaningful commitments and personal milestones. The floral arrangement and detailed band create a ring that feels distinctive while remaining versatile enough for everyday wear or sentimental gifting.

Product Information
SKU SHP-RINGS0821259391
Width 2.9 mm
Height 3.7 mm
Metal Weight 1.65 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Round-0.90X0.90 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings
What does a flower promise ring symbolize?
A flower-inspired ring often represents growth, beauty, and emotional connection. Many people choose floral designs for promise rings because they symbolize evolving relationships and meaningful commitments.
Is moissanite suitable for everyday jewelry?
Moissanite is known for its durability and strong sparkle, making it a popular choice for rings designed for regular wear.
What is beaded detail in a ring design?
Beaded detailing refers to small decorative metal accents along the band. These elements add texture and visual interest while enhancing the overall design style.
Can a promise ring be worn every day?
Many promise rings are designed for regular wear. Proper care and mindful handling help maintain the ring’s appearance over time.
How should a moissanite ring be cleaned?
Moissanite rings can be cleaned using mild soap, warm water, and a soft brush. Rinse gently and dry with a lint-free cloth before storing safely.