Certified Moissanite Eternity Evil Eye Necklace with Butterfly

Regular price $2,797.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A perfect mix of charm, protection and sparkle, this Eternity Necklace brings meaning and style together in one beautiful piece. The open circle design, lined with shimmering Moissanite stones, creates a sense of endless elegance and sophistication. On one side, a carefully crafted Evil Eye symbol adds a touch of mystique and is believed to ward off negative energy, while on the other, a graceful Butterfly motif represents transformation and freedom. The combination of these two powerful symbols makes this Moissanite Pendant Necklace a wearable reminder of positivity, growth and self-expression. This Butterfly Pendant Necklace pairs effortlessly with both casual and dressy outfits, adding a subtle sparkle to everyday looks or a refined shine to special occasions. Every detail is thoughtfully designed and it comes beautifully packaged in a jewelry box, making it a ready-to-gift treasure for someone you care about or a perfect indulgence for yourself. With its delicate sparkle, meaningful symbolism, and unique design, this Evil Eye Necklace stands out as a statement of personal style and inner beauty. It is a piece that celebrates protection, hope, and elegance all in one dazzling circle.

Product Information
SKU SHP-PENDANT032214191
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.71 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 26 Pieces
Total Weight 0.71 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-26 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
evil-eye-jewelry