Certified Moissanite Big Flower Stud Earrings

0
Regular price $1,826.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Radiate brilliance and artistry with these dazzling Moissanite Stud Earrings, designed to capture attention from every angle. Inspired by blooming florals, each earring is crafted with multiple layers of round shaped moissanites arranged in a captivating flower shape. The prong setting allows each stone to catch and reflect light beautifully, creating a luminous display of fire and sparkle. These Statement Stud Earrings deliver an impressive presence while maintaining balance and wearability. The layered construction adds luxury, giving the floral motif a bold yet graceful appearance. Moissanites are celebrated for their exceptional brilliance and durability, making these Flower Stud Earrings a striking choice for long-lasting shine and everyday confidence. Equipped with secure screw-back closures, the Moissanite Earrings offer a comfortable and reliable fit, ideal for extended wear during celebrations and formal events. Their radiant design makes them especially suitable for weddings, parties, and special occasions where elevated style is desired. Whether paired with bridal attire or worn as a standout accessory, these floral studs bring timeless charm, dramatic sparkle, and sophisticated craftsmanship to any jewelry collection.

Product Information
SKU SHP-EARRINGS042169023
Length 10 mm
Width 10 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 1.05 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 104 Pieces
Total Weight 1.05 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-16 Pcs
Round-0.90X0.90 mm-48 Pcs
Round-1.60X1.60 mm-16 Pcs
Round-1X1 mm-22 Pcs
Round-3X3 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings