Certified Moissanite Bar Dangle Earrings for Women

Regular price $2,017.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Sway with effortless elegance every time you move while wearing these Bar Earrings, designed to add a modern sparkle to your style. The Dangle Drop Earrings feature a sleek geometric rectangular motif that is beautifully outlined with petite Moissanite stones, creating a sophisticated frame that shines from every angle. From this elegant top, a Bar gently dangles below, also adorned with shimmering Moissanite stones that catch the light with every step you take. The graceful movement of the Bar gives these Moissanite Dangle Earrings a stylish, contemporary feel while still maintaining a timeless charm. The secure Screw Back Closure ensures they stay perfectly in place throughout the day or night. Whether you are dressing up for a dinner date, a festive celebration or simply adding a little sparkle to your everyday outfit, these Moissanite Earrings for Women make the perfect finishing touch. They arrive in a beautiful jewelry box, making them a thoughtful gift for birthdays, anniversaries, special occasions or a lovely treat for yourself. Chic and effortlessly stylish, these Moissanite Diamond Earrings are perfect for women who love jewelry that feels both modern and gracefully elegant.

Product Information
SKU SHP-EARRINGS082210295
Metal Weight 2.90 gm (Approximate)
Total Stone Weight 0.59 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 40 Pieces
Total Weight 0.59 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-40 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
dangle-earrings