Certified Lab Grown Diamond Star Pendant Necklace For Her

Sale price $2,045.00 Regular price $2,351.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Star-Inspired Diamond Pendant for Everyday Expression

This lab grown diamond star pendant necklace is designed for those who appreciate meaningful jewelry with a refined aesthetic. The star motif brings a symbolic element to the piece, often associated with guidance, individuality, and personal milestones.

Its delicate presence makes it suitable for everyday wear while still offering a distinctive look.

Star Design with Balanced Diamond Placement

The structured star silhouette is crafted to maintain clean lines and symmetry, allowing the diamonds to enhance its form without overwhelming it. Each element works together to create a balanced design that feels modern yet timeless.

The result is a pendant that stands out subtly rather than relying on excess detail.

Lab Grown Diamond Composition

The pendant features lab grown diamonds that offer a clear and consistent sparkle. These diamonds are created without traditional mining, though impact varies by production and energy source.

Their refined appearance complements the geometric nature of the star design.

Designed for Comfortable Daily Wear

The pendant is designed to sit comfortably along the neckline, making it easy to incorporate into everyday outfits. Its lightweight feel supports extended wear without distraction.

The simplicity of the design allows it to transition effortlessly from casual to more polished settings.

Versatile Styling and Meaningful Gifting

This star pendant pairs well with both minimal jewelry and layered necklace styles. It can be worn as a standalone piece or combined with other chains for a personalized look.

Its symbolic design also makes it a thoughtful gift choice for occasions that celebrate achievements, milestones, or personal journeys.

Product Information
SKU SHP-PENDANT082310768
Length 18.7 mm
Width 12.6 mm
Weight 3.60 gm (Approximate)
Center Stone Weight 0.25 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-necklace

Faq About: Certified Lab Grown Diamond Star Pendant Necklace for Her

Is a star pendant suitable for everyday wear?
Yes, its lightweight design and simple structure make it comfortable and easy to wear daily.
What does a star pendant symbolize?
Star motifs are often associated with guidance, hope, and individuality, making them meaningful for personal wear or gifting.
Are lab grown diamonds suitable for daily jewelry?
Lab grown diamonds are designed to offer durability and consistent sparkle, making them suitable for regular wear.
Can this pendant be layered with other necklaces?
Yes, its minimal design makes it easy to layer with other chains for a more personalized styling approach.
Does the pendant feel heavy when worn?
Lightweight pendant designs are typically comfortable for extended wear and do not feel heavy on the neckline.
Is this necklace a good gifting option?
Its symbolic star design and refined diamond detailing make it a thoughtful gift for various occasions.