Certified Lab Grown Diamond Infinity Stud Earrings

Sale price $3,412.00 Regular price $3,922.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Timeless Symbolism in a Stud Design

The Certified Lab Grown Diamond Infinity Stud Earrings are created for those who value meaningful design paired with refined simplicity. The infinity motif represents continuity and connection, expressed here in a compact stud format suitable for daily wear.

Designed to sit close to the ear, these earrings offer a balanced look that transitions easily from everyday styling to more formal occasions.

Infinity Form and Stone Placement

The infinity silhouette is structured to maintain visual symmetry while allowing the diamonds to follow the natural curves of the design. This arrangement enhances light reflection without overwhelming the overall shape.

The stud configuration is crafted for stability and ease of wear. Specific setting details and closure information are provided in the product tables below.

Lab Grown Diamond Value

Lab grown diamonds offer the same physical and optical properties as mined diamonds and are suitable for everyday jewelry. They are created without traditional mining, though environmental impact varies by production and energy source.

Certification details, stone specifications, and metal options are listed in the product detail tables on this page.

High-Level Features

  • Infinity-inspired stud earring design
  • Set with certified lab grown diamonds
  • Structured for secure and balanced wear
  • Suitable for daily and occasion styling
Product Information
SKU SHP-EARRINGS012410130
Metal Weight 5.50 gm (Approximate)
Total Stone Weight 2.60 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 44 Pieces
Total Weight 2.60 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Round-1.50X1.50 mm-42 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More
Are these earrings sold as a pair?
The included quantity is specified in the product detail tables above. Please refer to that section for confirmation before purchasing.
Are the lab grown diamonds certified?
Certification information for the diamonds is provided within the product details section on this page.
Can these studs be worn every day?
Lab grown diamonds are durable and suitable for regular wear. Proper care and periodic inspection help maintain their appearance and security.
What metal options are available?
Available metal types and finishes are listed in the product detail tables provided above.
How should I care for these diamond stud earrings?
Clean gently with a soft cloth and mild solution. Storing the earrings separately and scheduling occasional professional checks can help preserve their condition.