Certified Lab Grown Diamond Double Heart Promise Necklace

Regular price $3,489.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Symbol in a Refined Form

The Certified Lab Grown Diamond Double Heart Promise Necklace is designed to represent connection and commitment through a balanced, elegant silhouette. The intertwined heart motif offers a subtle yet expressive way to celebrate a promise, milestone, or personal bond. Its thoughtful proportions allow it to feel intimate and wearable, whether chosen as a romantic gift or a personal keepsake.

Double Heart Design with Delicate Structure

The double heart layout creates visual harmony while maintaining lightness on the neckline. Carefully positioned lab grown diamonds enhance the outline, adding controlled brilliance without overwhelming the design. The pendant is structured to sit naturally against the skin, making it suitable for layering or wearing as a standalone piece.

Lab Grown Diamond Value

Lab grown diamonds offer the same essential physical and optical properties as mined diamonds. They are created without traditional mining, though impact varies by production and energy source. When properly cared for, they are suitable for long-term, everyday wear in fine jewelry settings.

High-Level Features

  • Interlinked double heart motif symbolizing connection and commitment.
  • Certified lab grown diamonds for consistent brilliance.
  • Balanced pendant design suitable for daily wear or gifting.
  • Metal options and full specifications are detailed in the product tables above.
Product Information
SKU SHP-PENDANT062510059
Length 10.5 mm
Width 6 mm
Metal Weight 2.78 gm (Approximate)
Total Stone Weight 3.25 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 3.25 Carat (Approximate)
Dimension(approx) Heart-7.50X9.00 mm-1 Pcs
Heart-7X7 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade VS
View More

FAQs about: Lab Grown Diamond Double Heart Promise Necklace

Is this necklace suitable as a promise gift?
Yes, the double heart design is commonly chosen to symbolize commitment and emotional connection, making it a thoughtful option for promise occasions or meaningful milestones.
Are the diamonds in this necklace certified?
The product listing indicates certification. For complete details regarding grading or documentation, please review the specifications provided in the product information section.
Can this necklace be worn daily?
With proper care, lab grown diamond necklaces are suitable for regular wear. Removing the piece during strenuous activities can help maintain its finish and structure over time.
Does the pendant feel heavy on the neckline?
The design is intended to maintain a balanced and comfortable presence. For exact weight and dimension details, please refer to the product specification tables above.
How should I care for a diamond heart necklace?
Gentle cleaning with mild soap and water, followed by drying with a soft cloth, helps maintain brilliance. Storing the necklace separately can help prevent surface scratches.