Certified Lab Grown Diamond Cross Bracelet

Regular price $1,646.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Diamond Cross Bracelet represents spirituality, faith, and a divine connection. Its understated design goes beyond trends and seasons, showcasing timeless elegance. Featuring round cut lab-grown diamonds set in a cross design, this bracelet merges spiritual meaning with a simple style, making it a meaningful accessory that radiates understated elegance. Symbolizing hope, faith, and everlasting love, this Catholic Cross Bracelet has a unique charm and appeal. The cross motif hangs from a secure cable chain, attached with a lobster clasp for a perfect fit. Shine with sophistication and elevate your look with this signature style. With its charm and allure, this Cross Charm Bracelet perfectly blends prominence and elegance. The EF color VS clarity lab-made diamonds make a striking statement with their beauty and brilliance, turning heads with their style.

Product Information
SKU SHP-BRACELET052310013
Width 1.8 mm
Height 9 mm
Metal Weight 1.63 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More