Certified Lab Grown Blue Sapphire Flower Engagement Ring with Diamond

Sale price $2,610.00 Regular price $3,000.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The bloom of true love shines beautifully in this enchanting Flower Engagement Ring, a design inspired by the most delicate and meaningful forms of nature. At the center of the floral motif sits a radiant 5 mm Round Shape Lab Created Blue Sapphire set in Prong Setting, glowing with a rich and captivating blue that symbolizes loyalty, wisdom and lasting devotion. Surrounding the center stone, the flower-inspired design creates a graceful and romantic look that captures the beauty of a blossom in full bloom. The band continues the nature inspired story with elegant leaf details, gently adorned with sparkling Diamond stones that add a soft shimmer from every angle. Each curve of this Lab Grown Blue Sapphire Engagement Ring is thoughtfully crafted to reflect growth, harmony and the journey of two hearts coming together. Its delicate yet eye-catching design makes it perfect for someone who loves jewelry with meaning, charm and a touch of natural beauty. Whether chosen for a heartfelt proposal or to celebrate a special chapter in your love story, this Lab Blue Sapphire Diamond Ring carries a timeless sense of romance. Presented in a signature jewelry box and available in a variety of ring sizes for the perfect fit, this beautiful Nature Inspired Engagement Ring is a sparkling symbol of a love that continues to grow and blossom forever.

Product Information
SKU SHP-RINGS0821187959
Width 6 mm
Height 8 mm
Metal Weight 3.83 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
solitaire-engagement-rings