Certified Lab Grown Bezel Set Diamond Eternity Chain Bracelet

Sale price $3,828.00 Regular price $4,400.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Refined Diamond Bracelet for Timeless Wrist Elegance

The Certified Lab Grown Bezel Set Diamond Eternity Chain Bracelet is designed for those who appreciate clean design, refined sparkle, and modern luxury. Its continuous sequence of round lab grown diamonds creates a balanced and sophisticated look that enhances the wrist without appearing excessive. The result is a bracelet that feels contemporary while still honoring the timeless appeal of diamond jewelry.

This piece works beautifully as a standalone bracelet for elegant simplicity or as part of a layered stack for a more expressive style. The chain-based structure allows the diamonds to follow the natural curve of the wrist, giving the bracelet a fluid and graceful presence that suits both everyday wear and special occasions.

Why the Bezel Set Eternity Design Matters

The bracelet features a series of round diamonds secured within individual bezel settings. In this design approach, each stone is framed by a smooth rim of metal, creating a sleek and continuous visual rhythm along the bracelet. This setting style is valued not only for its modern appearance but also for the protection it provides to the gemstone edges.

A bezel setting allows the diamonds to sit neatly within the structure of the bracelet while maintaining consistent alignment and spacing. The result is a streamlined silhouette that reflects light from multiple angles while preserving a clean, minimal profile. The eternity-inspired layout ensures that sparkle appears evenly across the wrist.

Lab Grown Diamonds and Their Appeal

This bracelet is adorned with round lab grown diamonds chosen for their refined brilliance and clarity. Lab grown diamonds share the same physical and optical characteristics as mined diamonds, allowing them to deliver the same visual beauty when set into fine jewelry.

These diamonds are created without traditional mining, though environmental impact can vary depending on production methods and energy sources. Their durability and brilliance make them a practical choice for jewelry intended to be worn regularly while still offering the classic elegance associated with diamond pieces.

High-Level Design Features

The bracelet’s chain construction allows natural movement so the diamonds sit comfortably along the wrist. Its minimal framework keeps the focus on the stones themselves, while the repeating bezel settings create a structured yet delicate aesthetic.

Designed with versatility in mind, the bracelet transitions easily from daywear to evening styling. The balanced proportions make it suitable for wearing alone for understated refinement or pairing with additional bracelets to create a layered jewelry look.

Product Information
SKU SHP-BRACELET042510008
Metal Weight 6.20 gm (Approximate)
Total Stone Weight 2.53 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 2.53 Carat (Approximate)
Dimension(approx) Round-3X3 mm-23 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Bezel Set Diamond Eternity Chain Bracelet

What makes a bezel setting suitable for a diamond bracelet?
A bezel setting surrounds each diamond with a smooth metal rim, helping protect the stone edges while creating a clean and modern appearance. This style is commonly chosen for bracelets because it offers both visual refinement and practical durability.
Are the diamonds in this bracelet lab grown?
Yes. The bracelet features lab grown diamonds. These diamonds share the same physical and optical properties as mined diamonds but are created in controlled environments rather than extracted through traditional mining.
Can this diamond bracelet be worn every day?
Lab grown diamonds are durable and suitable for regular wear. For longevity, it is recommended to remove the bracelet during high-impact activities or situations where jewelry may come into contact with hard surfaces.
What occasions is this bracelet suitable for?
The bracelet’s minimal eternity design makes it versatile. It can be worn as an everyday jewelry piece, layered with other bracelets for styling, or chosen as an elegant accessory for special occasions.
What metal options are available for this bracelet?
The bracelet is crafted in precious metal options listed in the product specification tables on this page. Please refer to those tables for the exact metal variations currently available.
How should I clean a lab grown diamond bracelet?
Cleaning can be done using mild soap, warm water, and a soft brush to remove residue. After cleaning, gently dry the bracelet with a soft cloth. Periodic professional inspection can also help maintain its condition.