Certified Lab Created Diamond Crown Earrings for Women

Sale price $1,554.00 Regular price $1,787.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Regal Motif with Modern Refinement

The Certified Lab Created Diamond Crown Earrings for Women are designed for those who appreciate symbolic details paired with contemporary elegance. Inspired by the silhouette of a crown, the design reflects strength, individuality, and quiet confidence while maintaining a wearable scale suitable for daily styling.

Structured Crown Design with Secure Setting

The crown-inspired form is carefully structured to maintain balance and symmetry. Each diamond is positioned to highlight the shape without overwhelming the ear, creating a refined outline that catches light from multiple angles. The setting is crafted to keep the stones secure while preserving the clean geometry of the design.

Lab Created Diamond Value

Lab created diamonds are produced without traditional mining. Their environmental impact varies by production and energy source. When properly set and maintained, diamonds are suitable for everyday wear, making these earrings both symbolic and practical for long-term use.

High-Level Features

  • Crown-inspired silhouette for a distinctive, symbolic look.
  • Certified lab created diamonds as specified in the product details above.
  • Designed for balanced sparkle without excessive weight.
  • Metal options and full technical specifications listed in the product detail tables.
Product Information
SKU SHP-EARRINGS062510042
Length 6.7 mm
Width 6.7 mm
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 1.97 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 1.97 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Crown-Setting
Quality Grade VS
View More

FAQs about: Lab Created Diamond Crown Earrings for Women

Are these crown earrings sold as a pair?
The product listing specifies whether the earrings are sold as a pair or individually. Please review the product details section for confirmation before purchasing.
Do the earrings come with diamond certification?
Yes, certification details for the lab created diamonds are provided in the product specifications, confirming their stated characteristics.
Are lab created diamonds suitable for everyday wear?
Lab created diamonds share the same physical properties as natural diamonds and are suitable for daily wear when properly set and maintained.
Is the crown design appropriate for formal occasions?
The crown motif offers a distinctive yet refined appearance, making these earrings suitable for both formal events and elevated everyday styling.
Can these earrings be gifted for special occasions?
The symbolic crown design and certified diamonds make these earrings a meaningful gift choice for milestones, celebrations, or personal achievements.