Certified Diamond Three Heart Necklace

Sale price $2,655.00 Regular price $3,051.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Three Heart Design

This certified diamond three heart necklace is designed to represent connection, love, and continuity. The triple-heart motif offers a symbolic expression, making it a thoughtful piece for both gifting and personal wear.

Its balanced composition ensures the design remains elegant while still carrying emotional significance.

Refined Structure with Lasting Appeal

The necklace is carefully structured to maintain symmetry across all three heart elements. Each component is positioned to create a harmonious flow, allowing the piece to sit comfortably and naturally along the neckline.

The setting supports both durability and visual clarity, ensuring the design remains intact with regular use.

Diamond Accents for Subtle Brilliance

Diamonds bring a refined level of brightness to the necklace, enhancing the overall look without overwhelming its symbolic design. Their placement complements the heart shapes, adding light reflection and depth.

The use of certified diamonds ensures consistency in appearance and quality.

Designed for Everyday Wear

This necklace is suitable for daily styling due to its balanced weight and comfortable construction. Its versatile design allows it to be worn alone or layered with other pieces.

It transitions easily between occasions, making it a reliable addition to a jewelry collection.

Product Information
SKU SHP-PENDANT022210116
Length 21.5 mm
Width 37.5 mm
Height 1.8 mm
Weight 4.70 gm (Approximate)
Center Stone Weight 0.82 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 66 Pieces
Total Weight 0.82 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Round-1.40X1.40 mm-52 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.60X1.60 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
heart-necklaces

FAQs About: Certified Diamond Three Heart Necklace

What does the three heart design symbolize?
The three hearts often represent love, connection, and lasting bonds, making the design meaningful for gifting or personal wear.
Is this necklace suitable for daily wear?
Yes, its balanced design and structure make it comfortable and suitable for everyday use with proper care.
Are the diamonds certified?
Yes, the necklace features certified diamonds that ensure consistency in quality and appearance.
Can this necklace be layered with other pieces?
Yes, its minimal and balanced design allows it to be layered easily with other necklaces for a personalized look.
Is this necklace a good gift option?
Yes, its symbolic design makes it a meaningful gift for special occasions or personal milestones.
How should I care for this necklace?
Clean it gently with a soft cloth and store it separately to maintain its shine and avoid scratches.