Certified Diamond Lucky 4 Leaf Necklace

Sale price $2,783.00 Regular price $3,198.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Luck with Fine Diamond Detail

The certified diamond lucky clover leaf necklace is designed for those who appreciate symbolic jewelry with refined craftsmanship. The clover motif, long associated with good fortune, is elevated through carefully set certified diamonds that add light and definition.

Its balanced scale makes it suitable for daily wear while remaining distinctive enough for special occasions or meaningful gifting.

Thoughtful Design and Setting

The clover silhouette is structured for visual harmony, with each leaf proportioned to create a symmetrical and elegant outline. The diamonds are set to enhance the shape while maintaining a smooth, wearable profile.

Designed as a pendant necklace, the piece rests comfortably along the neckline, allowing the motif to remain the focal point.

Certified Diamond Assurance

The diamonds featured in this necklace are certified, providing documented grading information for added transparency. Diamonds are well-suited for regular wear when handled with appropriate care.

The combination of certification and symbolic design makes this necklace a considered choice for anniversaries, milestones, or personal keepsakes.

High-Level Features

  • Certified diamond accents
  • Lucky clover leaf motif
  • Pendant necklace design
  • Suitable for everyday and occasion wear
Product Information
SKU SHP-PENDANT032151691
Metal Weight 5.20 gm (Approximate)
Total Stone Weight 1.26 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 1.26 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
flower-jewelry
What does certified diamond mean for this necklace?
A certified diamond includes grading documentation outlining key characteristics such as cut, clarity, color, and carat weight, depending on the certification provided.
Is the clover pendant suitable for everyday wear?
Diamonds are durable and suitable for regular wear when handled with care. Removing the necklace during strenuous activities is recommended.
What does the lucky clover symbolize?
The clover motif is traditionally associated with good fortune and positive meaning, making it a thoughtful choice for gifting or personal significance.
Does this necklace include the chain?
This product is offered as a complete necklace. Specific details regarding chain length and metal options are listed in the product detail tables above.
Where can I find full specifications and metal options?
Complete specifications, dimensions, and available metal options are provided in the product detail tables on this page.