Certified Diamond Infinity Heart Necklace

Regular price $2,290.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Expression of Connection

The Certified Diamond Infinity Heart Necklace combines two enduring symbols—an infinity motif and a heart—into a single refined design. It is created for those who want to represent lasting affection, commitment, or personal milestones through fine jewelry.

Suitable for gifting or personal wear, this necklace offers a balanced presence that feels expressive without appearing excessive.

Infinity and Heart Design with Balanced Proportion

The infinity form flows seamlessly into the heart silhouette, creating a continuous line that symbolizes connection and continuity. The placement of diamonds enhances the outline, adding light reflection while preserving the clarity of the design.

The setting is crafted to hold each stone securely while maintaining a smooth profile that sits comfortably along the neckline.

Diamond Choice for Everyday Wear

Diamonds are valued for their durability and lasting brilliance, making them suitable for jewelry worn regularly.

With proper care and routine cleaning, a diamond necklace can retain its appearance over time. Periodic checks help ensure the setting remains secure.

High-Level Features

  • Infinity and heart-inspired silhouette
  • Diamond accents for refined sparkle
  • Designed for meaningful gifting occasions
  • Balanced for everyday elegance
Product Information
SKU SHP-PENDANT121911717
Length 13.5 mm
Width 20 mm
Metal Weight 3.40 gm (Approximate)
Total Stone Weight 0.26 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 27 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-25 Pcs
Round-1X1 mm-1 Pcs
Round-0.80X0.80 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces
What does the infinity heart design represent?
The infinity and heart symbols together commonly represent enduring love, connection, and commitment, making this necklace suitable for meaningful gifting.
Is this necklace suitable for everyday wear?
Diamonds are durable and appropriate for regular wear. Proper care and occasional inspection help maintain the setting and overall appearance.
Does the necklace come with certification?
Please refer to the product detail tables on this page for specific information regarding certification and included documentation.
What occasions is this necklace suitable for?
Its symbolic design makes it appropriate for anniversaries, birthdays, romantic milestones, or personal celebrations.
How should I clean a diamond necklace?
Clean gently using mild soap and lukewarm water, then dry with a soft cloth. Professional checks can help ensure the stones remain securely set.