Certified Diamond Infinity Heart Necklace For Her

Regular price $2,610.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Infinity Heart Necklace transcends the ordinary, capturing a moment in shimmering stones that reflect a graceful dance of love and infinity in pure brilliance. Crafted with meticulous care, its sleek design flows into a refined infinity symbol which is interlocked with an open heart motif at the center, embellished with breathtaking Diamond stones that sparkle with every flicker of light. Each HI color SI clarity Diamond in this Interlocking Necklace whispers feelings, holds memories, and keeps promises - together creating a stunning display that is impossible to overlook. The craftsmanship of this Diamond Pendant Necklace is remarkable, making it a genuine work of art. A symbol of your everlasting love and commitment, this necklace is meant to be treasured for all time. Suspended from a cable chain, this Diamond Infinity Necklace captures the essence of timeless connections that are deep and eternal. As a modern emblem of love, this Promise Necklace for Her signifies an everlasting bond, emerging as a lovely gift with intricate designs that truly resonate with the heart.

Product Information
SKU SHP-PENDANT022150412
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 31 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-18 Pcs
Round-0.90X0.90 mm-6 Pcs
Round-1X1 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
infinity-jewelry