Certified Cubic Zirconia Crown Engagement Ring

0
Regular price $1,633.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This one-of-a-kind Cubic Zirconia Engagement Ring is bound to catch eyes and win hearts. At its core is a dazzling 5X7 MM pear shaped cubic zirconia, held in a prong setting that highlights its shine and graceful teardrop form. Encircling the main stone is a stunning crown-like motif crafted from smaller round cut cz diamond stones, giving the Teardrop Engagement Ring a royal and romantic vibe. The chevron-style band features delicate side cubic zirconia stones, providing just the right touch of extra shimmer without overwhelming the overall design. The end result is a piece that exudes luxury, intricacy, and character, making it ideal for daily wear or special events. This Crown Engagement Ring fuses contemporary style with vintage allure, making it a gorgeous option for anyone who appreciates timeless elegance with a unique flair. Romantic, considerate, and sparkling, this Simulated Diamond Engagement Ring is more than mere jewelry, it represents love, royalty, and eternity.

Product Information
SKU SHP-RINGS072210293
Metal Weight 1.76 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
ZIRCON INFORMATION
No.of Stones 33 Pieces
Total Weight 1.55 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-1 Pcs
Round-1.10X1.10 mm-14 Pcs
Round-1.20X1.20 mm-9 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-2.20X2.20 mm-7 Pcs
Color White
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
halo-engagement-rings